PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018662
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 145aa    MW: 16637.7 Da    PI: 10.594
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018662genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.1e-1255105555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  ++err+ +NRe+ArrsR RKk  +e+L+e +k L+ eN++Lk  l +   +
  Lus10018662  55 RKERRMKSNRESARRSRWRKKRHLEKLTEQAKRLKMENQELKYMLGSTLSQ 105
                  79***************************************9777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.1E-1046100No hitNo description
SMARTSM003388.8E-1051115IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5535396IPR004827Basic-leucine zipper domain
PfamPF001706.1E-1055107IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.69E-1055105No hitNo description
CDDcd147021.10E-1456107No hitNo description
PROSITE patternPS0003605873IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MFGTTELDCP VHIEQGFTAH DLENLLSIFD SQTAGSPNNS NSGSEGWSNR SVDERKERRM  60
KSNRESARRS RWRKKRHLEK LTEQAKRLKM ENQELKYMLG STLSQCHVVR RDNQRLRSES  120
VALRGRLAHL CHTLLAMHGH AVNN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302393.22e-38bZIP transcription factor family protein
TrEMBLB9GNM42e-38B9GNM4_POPTR; BZIP transcription factor family protein
STRINGPOPTR_0002s11660.18e-38(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59963052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.17e-18basic leucine-zipper 5